SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra019977 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra019977
Domain Number 1 Region: 274-470
Classification Level Classification E-value
Superfamily HCP-like 0.00000139
Family HCP-like 0.033
Further Details:      
 
Weak hits

Sequence:  Bra019977
Domain Number - Region: 165-210
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 0.0209
Family CO dehydrogenase ISP C-domain like 0.01
Further Details:      
 
Domain Number - Region: 195-290
Classification Level Classification E-value
Superfamily TPR-like 0.0594
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra019977
Sequence length 593
Sequence
MDLMVSTSSVQEGFSLIQQLHREHKPSSKLDVLGRTSRNVNSRLSLGSRKRNRLVLASAA
SGLNGRAQKFETLASGVNGNGHYSSPNSSFALEDAESNNHLRQLVRTGELEEGFKFLENM
VYHGNVPDIIPCTTLIRGFCRMGKTKKAAKILEILEGSGAVPDVITYNVMISGYCRAGEI
TSALSLLDRMSVSPDVVTYNTILRSLCDSGKLKQAMEVLDRQLKRDCYPDVITYTILIEA
TCRESGVGEAMKLLDEMRVKGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSYGCQPN
VITHNIILRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAIDILE
KMPKHGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDG
KVEDAVEILNQLSSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLRPDTITYS
SLVGGLSREGKVDEAIKFFHEFERMGVRPNAVTFNSIMLGLCKTRQTDRAIDFLVYMINR
GCKPTETSYTILIEGIAYEGMAKEALELVNELCNKGLMKRSSAEQVAGKCSSK
Download sequence
Identical sequences M4DTY4
Bra019977 XP_009148305.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]