SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra020497 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra020497
Domain Number 1 Region: 163-376,409-443
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.71e-32
Family Nuclease 0.091
Further Details:      
 
Domain Number 2 Region: 503-614,660-746
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.49e-27
Family Polyphosphate kinase C-terminal domain 0.093
Further Details:      
 
Domain Number 3 Region: 7-35,60-159
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000194
Family PLC-like (P variant) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra020497
Sequence length 822
Sequence
MAEQLLLHGTLEVKIYRIDRLHKRGKFSLCGTGTGNKEPAGKKIQSPIKNLTSSCADLLG
GHLYATVDLDRARVARTTMRRHPKWFQSFHLYAAHSISKIIFTVKEDEPISANLIGRAYL
PVTEVITGQPVDRWLDLLDEHKSPIQGGSKIHVRVTFTSVTHDVNWNKGIVIPSFKGVPN
AFFNQREGCKVTLYQDAHVLEDYQDITLSGGQVIYSHHRCWEDIFDAIWDAKHLIYITGW
SVYTDITLIRDPKRPRQGGNLKLGELLKKKAEENVTVLMLVWDDRTSNEAFKRDGLMMTH
DQETYNYFKNTKVRCVLCPRNPDNGSSIVQGFEVAAMFTHHQKTVVVDAEVEGTKTKRRI
VSFLGGIDLCDGRYDTQEHPLFGTLNNFHSNDFHQPNFDGASIKKGGPREPWHDIHCKLD
GPAAWDVLYNFEQRWMKQGSGRRYLVSMERLSEITVPPLPFVKSDDVEGWTVQIFRSIDD
GAVLGFPEDPREASSVGLITGKNNVIERSIQDAYINAIRRAKHFIYIENQYFLGSSFGWS
SRDVNINEINALHLIPKEISLKIVSKIEAGERFSVYVVIPLWPEGKSGSASVQAILDWQR
RTMEMMYTDVVIALRKKGLDANPRDYLTFFCLGNREVNKAGEYSPPEKPAANSDYARAQE
SRRFMIYVHSKMMIVDDEYIIIGSANINQRSMDGGRDSEIAMGAYQPNHLLSTNQMKPTG
QVFSFRISLWLEHLRVITNPFMFPESEECIRMINAKADELWGLYSAQVYPRDHDLPGHLL
SYPISIGTNGEVTDLAGAELFPDTNAKVLGEKSNYLPPILTT
Download sequence
Identical sequences M4DVF3
Bra020497 XP_009129965.1.100322 XP_009129966.1.100322 XP_009129968.1.100322 XP_009129969.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]