SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra021132 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra021132
Domain Number 1 Region: 155-375,404-446
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.77e-33
Family Phospholipase D 0.067
Further Details:      
 
Domain Number 2 Region: 502-608,654-742
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.66e-30
Family Phospholipase D 0.06
Further Details:      
 
Domain Number 3 Region: 6-151
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.07e-18
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra021132
Sequence length 812
Sequence
MAQHLLHGTLHATIYEVDALHTGGLSSGFLGKIRANVEEAIGFGKGETQLYATIDLQKAR
VGRTRKITDEPKNPKWYESFHIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVINGE
EVEKWVEILDNDRNPIHGESKIHVKLQYFGVETDRNWNMGVKSAKFPGVPYTFFSQRQGC
RVSLYQGAHVPDNFVPKIPLAGGKNYEPHRCWEDIFDAITNAKHLIYITGWSVYTEITLV
RDSRRPKPGGDMTLGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEDTENYFN
GSEVHCVLCPRNPDDGGSIVQNLQVSAMFTHHQKIVVVDSEVPSQGGGGSEMRRIMSFVG
GIDLCDGRYDTPFHSLFRTLDTVHHDDFHQPNFTGASITKGGPREPWQDIHSRLEGPIAW
DVLYNFEQRWSKQGGKDILVKLRELSDIIITPSPVMFQEDHDVWNVQLFRSIDGGAAAGF
PESPEVAAEAGLVSGKDNVIDRSIQDAYIHAIRRAKDFIYIENQYFLGSSFAWAADGITP
EDINALHLIPKELSLKIVDKIEKGEKFRVYVVVPMWPEGIPESASVQAILDWQRRTLEMM
YKDVTQALRAQGLEEDPRNYLTLFCLGNREVKKEGEYEPAERPDPDTDYMRAQEARRFMI
YVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQVHGFRMS
LWYEHLGMLDETFLDPSSLECIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPISVDNEG
NISELPGFEFFPDTKARILGNKVDYLPPILTT
Download sequence
Identical sequences M4DX86
Bra021132 XP_009115281.1.100322 XP_013645091.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]