SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra021199 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra021199
Domain Number 1 Region: 345-455
Classification Level Classification E-value
Superfamily TPR-like 1.87e-21
Family Tetratricopeptide repeat (TPR) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra021199
Sequence length 464
Sequence
MNSNYGKRSSGSSINAFDFDLGLGSNQGKPLNGQKSQAPSYSQQPRPAFQPGKPSWTHQP
APKQTTIRSEIGGPTSMVGDIHGKTWNSSSSSSGSGSGIGIVNKDPSLFGDLVGSVIGKS
SGNVPLKKAPPKSSYSMGNLADALPKSGGNSMNSGGGGGGWGYSGNPGGVSGVNASNSIK
TPNLGGPSMKSMSGGNLSGSGVNSNSDPFGNLVGFGSKSSGSINSEKAKNDAKSDAAFGT
FQSGGFAGTATHNDDFGGFQDAAKSSTFSSGGFDASNVGFGVQSSVKDDPLGMFSTSTNT
SAAAAPQSEDWGFESFDGGADSGGGSTTELDGLPPPPPGVSAASAKSKGIDNQRQGQYAD
AIKWLSWAVILLERAGDDAGSAEVLSTRASCYKEVGEYKKAVSDCTKVLDHDEKNVTILV
QRALLYESMEKYKLGAEDLRMVLKIDPGNRIARSTVHRLTKMAG
Download sequence
Identical sequences M4DXF3
Bra021199 XP_009114517.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]