SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra021225 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra021225
Domain Number 1 Region: 29-179
Classification Level Classification E-value
Superfamily Plant invertase/pectin methylesterase inhibitor 9.68e-30
Family Plant invertase/pectin methylesterase inhibitor 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra021225
Sequence length 183
Sequence
MKNSSAVTSPLSLSLFLLFLLPFLAQSSDDLIDTICKATPFFDLCEASLRPLSPSPPDTK
SIASAMANVVLGNMTDTLGYIQSLIRHSQDPAAERALAQCAEVYRPVVRFNIPQAIEAMG
RGEFGFAMYVLGDAQKQSDSCQKWINSAGADDESSVPLTARNKLVKNLCDVEISVIKSLM
NGR
Download sequence
Identical sequences M4DXH9
Bra021225 XP_009114389.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]