SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra021226 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra021226
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Plant invertase/pectin methylesterase inhibitor 1.11e-32
Family Plant invertase/pectin methylesterase inhibitor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra021226
Sequence length 145
Sequence
MGDIVDKTCKQTPDYSLCLSLLRSDPRSSSADTVGLGLILVDKIKALGTETLGQINMAYK
TKPMLKKPLDECNLRYKTIVDVDVHTAIIAIRGNPKFAEGAIVDAGVEASVCEGGFPKGQ
SPITGLTQKMNKICDVTRAIVRMLL
Download sequence
Identical sequences M4DXI0
Bra021226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]