SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra021935 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra021935
Domain Number 1 Region: 106-256
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000506
Family Tetratricopeptide repeat (TPR) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra021935
Sequence length 293
Sequence
MASTGAAPDHLFNLRNQFYLGAYQTAINNSDIPHLSPEDAVERDCLVFRSYIALGSYQLV
ISEIDESAATPLQAVKLLAMYLSSPAHKESTISSLREWLADSTIGNNATLRLVAGIVFMH
EEDYSEALKHTHAGGTMDLHALNVQIFIKMHRSDYAEKQLGVMQQYDEDHTLTQLATAWF
NLAVGGSKIQEAYLIFQDFCEKYPMTCLILNGKAVCCMQMGNFDEAESLLLEALNKDAKD
PETLANLVVCSLHVGKSSSRYLSQLKLSHPEHVLVKRVSSAEDNFERAVQSVA
Download sequence
Identical sequences M4DZI8
Bra021935 XP_009141406.1.100322 XP_013744541.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]