SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra022229 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra022229
Domain Number 1 Region: 110-231
Classification Level Classification E-value
Superfamily TPR-like 7.59e-21
Family Tetratricopeptide repeat (TPR) 0.0099
Further Details:      
 
Domain Number 2 Region: 20-96
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000157
Family Thioredoxin-like 2Fe-2S ferredoxin 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra022229
Sequence length 294
Sequence
MASVALPAFTCRSSAEPTKELRVCTNRTCRKQGSFQILETLTSLAPPQLRVNPCGCLGRC
GSGPNLVALPQGLFLRHCATPSRAAEILFSLCGDGREASSSSAVAEALSALALTNNALTQ
IEAGNFEEAESLLTQALEMKPYGGLHRIFKHRAVAKLGMVDYSGALEDISQALALAPNYY
EPYIFQGDVYVAQGQYDLAEKSYLKCLEIDPTLRRSKSFKARIANLQKKAVEADLKTVEE
ERQILARMELETTDHSFLQNELSPTVWFAPSDFSMNEVKEKMAESIIKLENQLP
Download sequence
Identical sequences M4E0D2
Bra022229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]