SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra022238 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra022238
Domain Number 1 Region: 921-1105
Classification Level Classification E-value
Superfamily TPR-like 0.0000000341
Family HAT/Suf repeat 0.049
Further Details:      
 
Weak hits

Sequence:  Bra022238
Domain Number - Region: 197-449
Classification Level Classification E-value
Superfamily TPR-like 0.00126
Family Tetratricopeptide repeat (TPR) 0.051
Further Details:      
 
Domain Number - Region: 639-853
Classification Level Classification E-value
Superfamily TPR-like 0.0721
Family Tetratricopeptide repeat (TPR) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra022238
Sequence length 1152
Sequence
MWKTPEKGDGEQNTTGLFPLFPTQANSVSAISSAPQWLRNASFTTDLSVIDAAPSTAPSL
PDVEASEEEEEGDAYRNNTEANQPRVYDLIEEEEGSESDDDDKAKKKKKKKRKRDSDEYY
TKPAKDYYLDTRPDPDNLAYGSIYRMNVPRYKLDNSQRGFESGSTKLYLRNRRGSMLEAE
IDVNSLDGKAKSDNRYWYAKNAAMERNKNFRRIRLSASSREAVDSCFDRFIPLEEGEAVQ
ESEEEDVESKESVVGTSWEDEVLNKTREFNRQTREHPHDEKAWLAFADFQDKVSSMQSQK
GVRLQTLEKKISILEKAFELNPDSEELLLALLKAYRSRDSADVLISRWEKALMQNSSSYK
LWREFLRVVQGEFSRFKVSEVRKMYSYAIQALFSACSKRHRQMDATSEPVDSALIQQELV
LVDMLVSLCRFEWQAGYRELATALFQAEMEYSIFSPSLLLSEQSKLRLFEHFWSSNGARV
GEEGAFGWSLWLEKEEEQRQKMLKEESSDDNDVGGWTGWTEQLSDRKEEWAGWTEQLSDR
KEDSSIASANTGEGDVNREGLDEEMEDENGMPEDDTEAMLKLLGIDVDAAASDEIKDTST
WVKWFEEEVSRDQNQWMPTRKAGELSSVDEMGEREDEEQLSSLVLYEDINGYLFSLRSNE
ARLSLVYQFVDFFGANISPWTSSNSLWWIEKINSLETLSDSMLENLRNVHECLSKSDSAN
GFSLGSLLGSNSDISMRTEMMKFLRNAILLCLNVFPRNYILEEAVLVAEELFVTNMKTCE
VATTPCQALAKRLLKSDRQDLLLCGVYAQREAASGNMKHARRIFDMALTSICGLPKELQD
NSPLLYLWYAESEVANSSGSSLETESSSRAMHILCYLGSGLAYVPYSSQPSSMQILRARQ
GFREKLKKIQSLWSHGVTDDQSAALVCSAAVFEELTNDLSGAVEILEHMFSSVLPGRRSQ
SHQLEILFNYYVRMLQRHQDDLTLSKLWNPISEGMQLYPLSPELYQALIDICNHRMTSHR
LRMMFDDYSRKTPSVVVWLFALSYELSRGGSLHRIRGLFERALAQDTLNSSVILWRCYIA
YEIDIAHNPSAARRIYFRAINACPWSKKLWLDGFGKLSTVLTAKEMSDLQEVMRDKELNI
RTDIYEILLLQG
Download sequence
Identical sequences M4E0E1
Bra022238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]