SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra022740 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra022740
Domain Number 1 Region: 2-107
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.000000000493
Family Nuclease 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra022740
Sequence length 126
Sequence
MSIHAAYVKAIRSAQHFIYIVNQYFLGSSIIQLGFKQGLGSFGIAGANNLIPIEIALKIA
NKIRARGKFAAYIVIPMWPEGAPTSNPIQRILYWQHKTMQMMYQTIHKALVEVGLDGQYE
PQDFII
Download sequence
Identical sequences A0A078GTC9 M4E1U0
Bra022740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]