SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra023523 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra023523
Domain Number 1 Region: 6-159
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 6.63e-52
Family Pollen allergen PHL P 1 N-terminal domain 0.0035
Further Details:      
 
Domain Number 2 Region: 139-230
Classification Level Classification E-value
Superfamily PHL pollen allergen 4.71e-29
Family PHL pollen allergen 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra023523
Sequence length 234
Sequence
MSTSAATNAENGWVDAHATFYGGRKGEETMQGACGYGSLFEQSYGLATAALSTALFNNGT
TCGACYEIICVNAPQSCIKGARPIRVTATNWCPPNYRDGSWCNPPRKHFDLSLPIFLKIA
KYKAGIVPVKYRRVMCPKKSGVKFQLAGNPYFLMVTVFNVGRVGVVVEVKVKGSKTGWIQ
MTRNWGQVWDTNTVLTGQSLSFLVATSDGKRLKFNNVAPSNWQFDKTYDGKINF
Download sequence
Identical sequences M4E420
Bra023523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]