SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra024360 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra024360
Domain Number 1 Region: 229-331,373-452
Classification Level Classification E-value
Superfamily TPR-like 5.31e-28
Family Tetratricopeptide repeat (TPR) 0.0037
Further Details:      
 
Domain Number 2 Region: 463-575
Classification Level Classification E-value
Superfamily TPR-like 6.51e-24
Family Tetratricopeptide repeat (TPR) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra024360
Sequence length 586
Sequence
MGENAAQRRSGCGLLSVMFGRRNLWSKKPTPTDNGSQKSTSTAATATSNIQFTKSPGNDL
KKPHHDVKVSVETIQNNKIQNQNQRSVVPSKPSSNQYPNNHQLGTYENQQRSSYNNNSSS
VDPYRGGQRKVPREAIGLSGELESMITDHQKSRGANGLVRASSSNVMLYGNLGNLNQSGP
ATTLGYGNVNSGGGYVATRTNVAAPATVTTKSQDQSGSLCRAISTRMDPETLKIMGNEDY
KNGNFAEALALYDAAIAIDPNKAAYRSNKSAALTALGRILDAVFECREAIRIEPHYHRAH
HRLGNLYLRLGEVEKSIYHFKHSGPEADPEDIVKAKAVQTHLNKCTEAKRLRDWNGLITE
TTNTISSGADAAPQVYALQAEALLKTHRHQEADDALSKCPVFDVETSTRYYGPVGYAGFL
VVRAQVHLASGRFDEAVEAIQRAGQLDGNNREVAMVSRRAQAVTEARFRGNELFKDGRFE
EACAAYGEGLDHDPRNSVLLCNRAACRSKLGQFEKSVDDCTAAISVRPGYRKARLRRVDC
NTKMRKWELVVADYEILKKETPEDEEVTRGLSEAQQQLMKRRGQDS
Download sequence
Identical sequences M4E6F6
XP_009150598.1.100322 XP_013643092.1.73403 Bra024360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]