SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra026125 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra026125
Domain Number - Region: 409-472,539-719
Classification Level Classification E-value
Superfamily TPR-like 0.0182
Family Tetratricopeptide repeat (TPR) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra026125
Sequence length 864
Sequence
MASSSQTPHFHLNPSKSKPFHRKSRNHRNVNFHWNFGIRKLILRKSQGLSVLSSSSSSTH
FSNSQLHGLCANGKLDEAIKLVASMQELRVTVDEDAFVALVRLCEWKRAHEEGSKVYDIA
MGSMSSLGVELGNAFLAMFVRFGNLVDAWYVFGKMSERDLFSWNVLVGGYAKQGYFDEAM
CLYHRMLWVGGVKPDVYTFPCVLRTCGGIPDLARGREVHVHVVRYGYELEIDVVNALITM
YVKCGDVGSARLVFDRMPRRDLISWNAMISGYFENGMCCEGLELFFAMRGLSVDPDLMTM
TSVISACELLGDGRLGRDIHAYVITSGFAVDMSVCNSLTQMYLYAGSWREAEKVFSRMER
KDIVSWTTMISGYEYNFLPGRAIDAYRMMDQDCVKPDEIAVAAVLSACATLGDLDTGVEL
HKLAIKARLVSYVIVANNLINMYSKCKCIDKALDVFHNIPRKNVISWTSIIAGLRLNNRC
FEALIFFRQMKMTLQPNAITLTAALAACARIGALMCGKEIHAHVLRTKVGLDDFLPNALL
DMYVRCGRMNIAWNLFNSQRNDVSSWNILLTGYSERGQGSVVVELFDRMIKSRVRPDEIT
FISLLCGCSKSQMVKEGLTYFSRMEEYGVTPNLKHYACVVDLLGRAGELEEAHSFIQRMP
LVPDPAVWGALLNACRIHRDIKFGELSAKRIFELDKESVGYYILLCNLYADCNKWREVAK
VRRMMKENGLTVDAGCSWVEVKGKVHAFLSDDKYHPQTKEINTVLERFYEKMSEVGGLTK
TSSMGEAEISRDEIFCGHSERKAIAFGLINTVPGMPIWVTKNLNMCESCHDTVKFISKTV
RREISVRDAEHFHHFRDGECSCGD
Download sequence
Identical sequences A0A078HGQ6 M4EBG6
XP_009148949.1.100322 XP_013641492.1.73403 Bra026125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]