SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra027029 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra027029
Domain Number - Region: 11-199
Classification Level Classification E-value
Superfamily TPR-like 0.00417
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra027029
Sequence length 243
Sequence
MLNIVTYTSLVKGLCNLGRWSDAAGLLSHFIKREISPNVITSTALVDAFVKNGKVLEAKE
LYEEMIRMSIEPDIVTYSSLINGLCMQDRVDEASEMFGLMVRRGCFPDVVSYNTLINGFC
KAKRVEDGMRLFREMSQRGLVSSTVTYNTLIQGFFEAGDVDMAQEVFRQMDSPDIWTYNI
LLGGLCDNGEVEKALVMFEDLQKSEMELDIVTYTTIIHGMCKSANSSTFSGDGITGTLPS
TPN
Download sequence
Identical sequences M4EE19
Bra027029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]