SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra027062 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra027062
Domain Number 1 Region: 95-157,222-294,354-392,531-618
Classification Level Classification E-value
Superfamily TPR-like 0.000000212
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 
Weak hits

Sequence:  Bra027062
Domain Number - Region: 296-377
Classification Level Classification E-value
Superfamily TPR-like 0.0326
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra027062
Sequence length 658
Sequence
MSRSRGIFSILRKVHQPSSRKCLRTNSISSSSSSSLGFRATNKELNQMIRSGYIAEARKI
FEKLEARNTVTWNTMISGYVKRREMTNARKLFDEMPQRDVVTWNAMISGYVSCGFLEEAR
KLFDEMLKRDSFTWNTMISGYAKNRRIGEALLLFERMPMRNAVSWSAMISGFCHNGEVSR
GVELFMRMPEKDSACLCALVSGLIKNEKLEEAANVLTQYGCVDSGKEDLVFAYNTLVVGY
GQRGQVEAARRVFDQIPDICRNYVSWNSMIKAYLKAGDVVSARLLFDQMRDRDTISWNTM
IDGYVHVSKMDEALCLFSEMPNRDTHSWNMMVSGYASVGDVELSRDYFERTPEKNIVSWN
SIIAAYEKYKDYKEAVEVFIRMNTEGEKPDPHTLTSLLSVSTGLVNLRLGMQMHQIVLKS
VIPDVPVHNALITMYSRCGDITDSRRIFDEMRVKREVITWNAMIGGYAFHGNSSEALNLF
WSMKSNGIHPSHITFVSVLNACAHAGLVDEARAQFMSMVNEYKIQPQMEHYSSLVDVISR
QGRFEEAMGVIKSMPFEPDKTVWGAVLDACRIYNNVGLAHAAAEAMSRLEPESSTPYVLL
YNMYADMGLWDEASQRTEDEGYDDQELRDGISVSILLGTHSHRFPNGVVEAVEESPPE
Download sequence
Identical sequences M4EE51
Bra027062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]