SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra027209 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra027209
Domain Number 1 Region: 155-373,402-441
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 8.16e-36
Family Phospholipase D 0.092
Further Details:      
 
Domain Number 2 Region: 489-606,652-740
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.59e-29
Family Phospholipase D 0.083
Further Details:      
 
Domain Number 3 Region: 5-151
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.07e-19
Family Synaptotagmin-like (S variant) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra027209
Sequence length 810
Sequence
MAQHLLHGTLHATIYEVDDLHTGGLRSGFFGKILANVEETIGVGKGETQLYATIDLQRAR
VGRTRKIKDEAKNPKWYESFHIYCAHLASDIIFTVKDDNPIGATLIGRAYVPVDQILHGE
EVDQWVEILDNDRNPIHGGSKIHVKLQYFGVEADRNWNQGIKSAKFPGVPYTFFSQRQGC
KVSLYQDAHIPDNFVPRIPLAGGKNYEPQRCWEDIFDAISNAQHMIYITGWSVYTEIALV
RDSRRPKPGGDMTVGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEETENFFR
GSDVHCILCPRNPDDGGSIVQNLQVSAMFTHHQKIVVVDSEMPSQGGSQMRRIVSFVGGI
DLCDGRYDTPFHSLFRTLDTVHHDDFHQPNFPGAAITKGGPREPWHDIHSRLEGPIAWDV
LYNFEQRWSKQGGKDILVKLRELSDIIITPSPVMFQEDHDVWNVQLFRSIDGGAAAGFPE
SPEAAAEAGLVSGKDNIIDRSIQDAYIHAIRRAKDFIYIENQYFLGSSFAWAADGITPED
INALHLIPKELSLKIVSKIEKGEKFRVYVVVPMWPEGLPESASVQAILDWQRRTMQMMYK
DIVQALRAQGLEEDPRNYLTFFCLGNREVKKEGEYEPAERPDADSSYMRAQEARRFMIYV
HTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHQLSHRQPARGQIHGFRMSLW
YEHLGMLDETFLDPSSVECIEKVNRISDKYWDLYSSESLEHDLPGHLLRYPVDVDAEGDV
TEFPGFEFFPDTKARILGTKSDYLPPILTT
Download sequence
Identical sequences M4EEJ7
Bra027209 XP_009146200.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]