SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra027272 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra027272
Domain Number - Region: 144-448
Classification Level Classification E-value
Superfamily TPR-like 0.00243
Family Tetratricopeptide repeat (TPR) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra027272
Sequence length 528
Sequence
MRGKYKSEILFQLRNALCRRRISSPTSSAFIRRLSPPEKLDHKHNITLTEFRFLGVNQSP
HFLHSLTPPDRNSLGHDKQSALDVHNVLKNHRGSSPEEIERILEKCGIVLTEGMILEVVN
RNRSDWKPAYTLSRLIRKRSVYMFSSSVYNEILDVLGKMRRFEEFHQVFDEMSERDAKTY
KVLLNRYAAAHKVVEAVKVFERRREFGIEDDSVAFHGLLKWLCRYKHVEFAETLFCSRGR
EFVGCDIKAMNIILNGWCVLGNVHEAKRFWKDIIASKCRPDVVSYGTMINALTKKGKVGK
AMELYRAMWKTGRNPDVKICNNVIDALCFKKRIPEALGVFKEMGEKGCSPNVATYNSLLK
HLCRIRRTEKVWELVEEMEDKGGSCSPNDVTFGYLLKYSQKPEDVEAVLERMRKNMCEMT
SDLYNLVFRLYVQWGDEEKAREVWNEMERSGLGPDQRTYTVKVHGLHSKGKIGEALSCYR
EMMSRGMVPEPRTEILLNQTKAKRKEEDDKKLRLNSTEDETEVVMNYT
Download sequence
Identical sequences M4EER0
XP_009146280.1.100322 Bra027272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]