SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra028625 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra028625
Domain Number 1 Region: 60-137
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.57e-22
Family Inorganic pyrophosphatase 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra028625
Sequence length 166
Sequence
MAATRVMMTAAQTTSCFLAKRAFLLPAKTSHGALCFNRRALALKSKRPFSCSAIYNPQVK
VKEEGQPETLDYRVFFLDGSGKKVSPWHDIPLSLGDGVYNFIVEIPKESKAKMEVATDEA
STPIKQDTKKGKLRYYPYNIKTTRSQMGSLLTDSALETNQLTKTMH
Download sequence
Identical sequences M4EIL0
XP_009125356.1.100322 XP_013678500.1.73403 Bra028625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]