SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra028700 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra028700
Domain Number 1 Region: 736-997
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.55e-44
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0041
Further Details:      
 
Domain Number 2 Region: 325-551
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.78e-38
Family Tyrosyl-DNA phosphodiesterase TDP1 0.005
Further Details:      
 
Domain Number 3 Region: 32-80,107-137
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000000105
Family FHA domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra028700
Sequence length 1060
Sequence
MKRRHSDKVSIRIHNIGTPLISRSTGSPIESLHVESDRPYTIGRSTANGSCDFVLDHVGI
SRNHCQILFDSRSSKLYVFDGVILSNYSGGFSQFFNEVEKEGLRFKVSLNGVYVNRVKVG
KGRVQEVLVGDEVLFVCGKEGLLCCKDERVGFVVQEIGFEGRDTSVSEGHSRGSFSSGKR
SKRVFAPMENEVSSMVSGVKAVGGVVERLNSLVRYCRHVLNSDDPVSCLRLSDSGKECVS
YCTMLRLKGGIVKDNREVRSDEENHEMSGLKVRDEQPSPQLHIDRSIVVSNLVSQVESDG
AACISVSDKARTMIPIDEEKENTPGNSYFTKEKSYQSSGKNFYLNRLQYIEHDPTGSQRV
VSLPELLHPVESISQIFIATFTSDILWFLTGCEIPSHLPVTVACHHAERCWSSSPDSRTA
APLPNYPNVTMVFPPFPEEIAFGKDRKNQGIACHHPKLFILQREDSLRVIITSANLVARQ
WDDVTNTVWWQDFPRRANPDYLSLFSHFKKETNRGLSSDFGAQLAGFAATLLADVPSQAH
WILELTKYNFEHSAGHLVASVPGVHSYKPSYLTESVRSSSAFNEEFLGSVEASVVGLSYL
FRSTSDSTGAQLKRLASYISRTRENSLGMLELVMRRNTSVPADVNAVSVLVPNPDDDSRD
EFVQLGFLPRNIAKWVSPLWDIGFFKFVGYVYRDEVLASASCRSNQKVQLMLHVLQGVSI
SEMSKLILPHHVVALCSLIASLQRCTGIWRLQEVLGCYKWPESQESDFVYSASSVGGSVT
AGFQADFASAAGKKALQHFDSQESDPEWGCWSAREEREAPSIKIIFPTIERVKNGLRGVL
SSRRLLCFSDKTWQKLRYNNVLHDAVPNPQDRVGHPMHIKVARRRFTSTRGLGSSSFGWV
YCGSHNFSAAAWGQTISRSSRTNQDQSYNAMRVVSKLRVCNYELGIVFVFPPPHEETDLC
DGSKIDDIVLPFIVPAPKYGGSDRPATGLAMREALAEFREGSRSVFGENEVEEVEEEEED
EAEAEAEAEGRGEFVVEEEKQEEKAYGEALWSQVESSLSS
Download sequence
Identical sequences M4EIT5
XP_009125687.1.100322 Bra028700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]