SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra030321 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra030321
Domain Number 1 Region: 112-205,389-423
Classification Level Classification E-value
Superfamily TPR-like 0.0000152
Family BTAD-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra030321
Sequence length 488
Sequence
MHFRNLYSWNNMISGYVKSGMLTRARVVFDGMPERDVVSWNTMVIGYAQSGNLNEALWFY
RELRRSGIKFNEFSFAGVLTACVKSRELGLNRQAHGQVLVAGFLSNVVLSCSIIDAYAKC
GQMESARRRFDEMVVKDNYIWTTLISGYAKLGDMESANELFTKMPEKNPVSWTALIAGYV
RQGSGDHALDLFRKMIALRVKPEQFTFSSCLCASASLRHGKQIHGYMIRTNVVPNAIVVS
SLIDMYSRSGSLESSERVFNLYGDDKRDCVLWNTMISALAHHGLGHKALRMVDEMIKIGV
NPNRTTLVVILSACSHSGLVEEGVRWFDSMTVDYGIVPDQEHYACLIDLLGRAGCFKELM
SRMEKMPFKPEEHIWNAILGVSRIHGNVELGKRAAEELIRLDPESSAPYVLLSSIHADQG
NWEPVEKLRGIMKKRRVNKEKARSWIGIGEKVETFTVSDGWHHPRKEEIYSVLHNLAALM
EKEEASRT
Download sequence
Identical sequences M4ENF1
Bra030321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]