SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra030375 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra030375
Domain Number 1 Region: 154-374,403-441
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.7e-35
Family Phospholipase D 0.056
Further Details:      
 
Domain Number 2 Region: 491-607,654-742
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.75e-29
Family Phospholipase D 0.083
Further Details:      
 
Domain Number 3 Region: 6-152
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.68e-17
Family PLC-like (P variant) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra030375
Sequence length 812
Sequence
MEEFLLHGRLHATIYEIDALHATQGGRSGFLGKMLANVEEKIGVGKGETQLYATIDLEKA
RVGRTRKITNEPKSPKWHESFHIYCGHMAKHVIFTVKDDNPIGATLIGRGYVPVEDILHG
EEVDRWVEILDTEKKPIEGGSKIHVKLQYFGVEKDKNWNRGIKSAKFPGVPYTFFSQRKG
CKVSLYQDAHIPGNFVPKIPLAGGKHYEAGRCWEDIFDAITNAKHLIYITGWSVYTEISL
VRDSRRPKEGGDVTIGEILKKKASEGVKVILLVWDDRTSVDLLKQDGLMATHDEETANFF
RGTDVNCVLCPRNPDDGGSIVQNLQVSTMFTHHQKIVVVDSEMPGTARTKSRRIVSFVGG
LDLCDGRYDTPFHSLFRTLDTAHHDDFHQPNFTGAAITKGGPREPWHDIHCRLEGPIAWD
VLYNFEQRWSRQGGKDILVKIRDLDDIIVPPSPVLFSEDHDSWNVQLFRSIDGGAAAAFP
ESPEAAAEAGLVSGKDNIIDRSIQDAYIHAIRRAKDFIYIENQYFLGSSFAWSADGIKPE
EINALHLIPKELSLKIVSKIKAGEKFKVYAVVPMWPEGLPESGSVQAILDWQRRTMEMMY
KDVIKALRDKGLEGEDPRDYLTFFCLGNRETKKDGEYVPSEKPEPDSDYMRAQEARRFMI
YVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSIRQPARGHIHGFRMS
LWYEHLGMLDETFLDPSSQECVQKVNRIADKYWDLYASESLEHDLPGHLLRYPIGIASQG
DITELPGCECFPDTKARILGTKSDYLPPILTT
Download sequence
Identical sequences M4ENK5
Bra030375 XP_009144830.1.100322 XP_013746608.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]