SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra030534 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra030534
Domain Number 1 Region: 423-446,508-583
Classification Level Classification E-value
Superfamily TPR-like 0.00000464
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 
Weak hits

Sequence:  Bra030534
Domain Number - Region: 377-524
Classification Level Classification E-value
Superfamily TPR-like 0.000156
Family Tetratricopeptide repeat (TPR) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra030534
Sequence length 604
Sequence
MNLILKRHFSQRLTPLVSPSSPTKQSRIRELCKSGRLTDAIRILNTTLSCEISAKPNLYA
TLLQTCTKVLSFTHGLQFHAHVVKSGLETDRYVGNSLLSLYFKLGHDMKETRRVFDGMFV
KDAISWSSMMSGYVRGKEHVEALEMFGEMVSFGLDPNAFTLSGAVKACSEIGDVRLGRCF
HCLVIARGFEWNHVISSTLAYMYGVNQEPVDARRVFDEMPEPDVFSWTAVLSAYSKNDLY
EEALGLFYVVNRGKGLVPDESTFGTVLTACGNLRRVKRGKEIHGKLITNGISSNVVVESS
LLDMYGKCGSVREARQVFNGMSKKNTVSWSALLGGYCQNGEHERVIEMFREMEEKDLYCF
GTVLKACAGLAAVRLGKEVHGQYVRRGCRDNVIVESALVDLYGKSGCVDSATRVYSKMAI
RNMITWNAMLSALAQNGRGEEAVSFFDDMVKKGIKPDYISFIAVLTACSHTGLVEEGRNY
FAMMTDSYGIKPGTEHYSCMVDLLGRAGLFEEAENMLERAECKDDASLWGVLLGPCAANA
DALAIAERIAKRMMRLDPKYHMSYVLLSNMYKSIGRHGDALKIRRLMVRRGVTKTIGQSW
IDAH
Download sequence
Identical sequences M4EP14
XP_009111152.1.100322 Bra030534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]