SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra030554 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra030554
Domain Number 1 Region: 315-611
Classification Level Classification E-value
Superfamily TPR-like 2.8e-38
Family HAT/Suf repeat 0.028
Further Details:      
 
Domain Number 2 Region: 85-254
Classification Level Classification E-value
Superfamily TPR-like 4.36e-34
Family HAT/Suf repeat 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra030554
Sequence length 748
Sequence
MGESQAMVAEGYNASAATVESNVDSSQSVANVSLVNGTGPEGGSTASAENGTATDNVPVT
APGAGHIDNAGSALSPEEERLWSIVRANSSEFNAWTALIEETERISQDNISKIRKVYDAF
LAEFPLCYGYWKKYADHEARVGAMDKVVEVYERAVQGVTYSVDIWLHYCVFAINTYGDPD
TIRSLFERAVVYVGTDFLSSPLWDKYIEYEHMQQDWSRLAMIYTRILENPIQNLDRYFNN
FKELAETRPLSELRSAEESATVAVASDASETALSESDGKADEGKSQADGTSEPSKLESAG
STDPEELKKYIGIREALYIKAKEFESKIIGFEMAIRRPYFHVRPLNVAELENWHNYLDFI
ESDGDFNKVVKLYERCLVACANYPEYWIRYVLSMGSSGSMDLADNALTRATQVFVKRQPE
IHLFAARLKEQNGDIAGARAAFQLLHSEISPGLLEAVIKHANMEQRLGNVDDAFSVYEQV
IAVEKGKDNSILLPLLYAQYSRFSYLVLRDAEKARKIIVEALDHVQPSKHFMEALIFFET
ILPPPRKIEYLDPLVENLIKPNVDTQNTASSTEREELSLIYIEFLGLFGDVESIKKAEDR
HCKLFLPHRSRSELKKRSADEFLSSDRTKLAKTYNETAPAQPVSNAYPNAPAQWSGGYAA
QPQAWPQPQAAPAQPQQWNPAYGQQQAAYGAYGGYPAGYAAPQAPTPVPQAAAYGAYPPQ
AYPATAPLAAPVQQPAAAPPQAYYNTYY
Download sequence
Identical sequences M4EP34
XP_009111127.1.100322 Bra030554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]