SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra030624 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra030624
Domain Number 1 Region: 146-193,345-428
Classification Level Classification E-value
Superfamily TPR-like 0.0000307
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 
Weak hits

Sequence:  Bra030624
Domain Number - Region: 114-263
Classification Level Classification E-value
Superfamily TPR-like 0.00062
Family BTAD-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra030624
Sequence length 492
Sequence
MALLPAVGIPSPAPPQQIPFISRNNHTNPKTTSETTVSWTSRITLLSRNGRLAEAAKEFT
AMRLAGVEPNHITFIALLSGCGDCEDLGVSLHGYACKLGLDRNHVMVGTAIIGMYSKRRR
FRKARLVFDRIEDKNSVTWNTMIDGYMRSGRVDDAAKVFDEMPERDLISWTAMINGFVKK
GLHEEALAWFREMQVSGVKPDYVAVISALAACTSLGALSFGLWVHRFVVSQDFKNNVRVS
NSLIDLYCRCGCVEFARQVFDEMEKRTVVSWNSVIVGFAANGHAHESLVYFRRMQEERFK
PDAVTFTGALTACSHVGLVAEGVGYFEAMKRDYRISPRIEHYGCLVDLYSRAGRLEEALK
VVESMPMKPNEVVIGSLLAACRTHGNDTELAERMMKRLSELKVKGHSNYVILSNMYAADG
QWEGASKMRRKMKGLGLKKQPGFSSIEIDDRTHVFMAGDSAHVENGYIREVLELISSDSR
LQCSVVETLGGD
Download sequence
Identical sequences M4EPA4
Bra030624 XP_009111029.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]