SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra030764 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra030764
Domain Number - Region: 175-245
Classification Level Classification E-value
Superfamily TPR-like 0.0038
Family Tetratricopeptide repeat (TPR) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra030764
Sequence length 489
Sequence
MFLFASCRSIASRSHTIIKRSYTNLSIKHLSSLLRKNESDPRIIHQLHSHFITAGLLLLH
QEQNSKKLLLFNPLLRCYSLGETPLRAYFLYDQLQQLHFLSDHEQRLPPFDSYTYLFLIK
ATSNTLLGIGLHGLTLKLGFEFNVYVQTALVGMYIGAGNRVDAYKVFDEMPERSPVTWNV
MITDLTNLGEFEKALSLLEKMPNRNVVSWTTLIDGYARVNKPKEAILLFRRMACDAIKPN
EITILTILPAVWSFGDLRMCGSVHGYAVKRAFVPQDIRVTNSLIDAYAKCGCIQSSLKFF
MDVPNERKNLVSWTTMISAFAMHGMGKEAVSMFKDMERMGLKPNRVTMISVLNACSHGGL
AEEEFLEFFNKMVSKYKITPDVKHYGCLVDMLRRKGRLEEAERIALEIPSDQKAVVWRML
LGACSVYDDPEMAERVTKKLMELERSHGGDYVLMSNIFCGTGRFTDGERFRKLMDVRGVA
KLPGHSQLT
Download sequence
Identical sequences M4EPP4
Bra030764 XP_009110841.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]