SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra031038 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra031038
Domain Number 1 Region: 282-465
Classification Level Classification E-value
Superfamily PUA domain-like 2.01e-28
Family LON domain-like 0.029
Further Details:      
 
Domain Number 2 Region: 193-261
Classification Level Classification E-value
Superfamily RING/U-box 1.48e-18
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 39-174
Classification Level Classification E-value
Superfamily TPR-like 2.45e-16
Family Tetratricopeptide repeat (TPR) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra031038
Sequence length 475
Sequence
MSNEESLPAFTLFGLDEVENYGLVSEADNSLPLDIHNQVFQLVEKGNEAFKESHRFEEAI
SNYSKANSVKPLDPVVLTNRSAAYIRFGQYLKQRSASISEYRPLNGFDMSMLGELALKDA
DKVMNIHSSSVKSYITKACALMLLERYEAARETILSGLQIDPFSDPLRSNLQELEKVMMP
TSTRKSHGKAERSDDFDCTVCLKLLYDPATTPCGHTFCRSCLFQSMDRGNKCPLCRTVIF
MTPRTCAVSVTLNNIIQKNFPEEYAERKSEQDTLVHLGNESMPLFVMDVIIPCQKLSLHI
FEPRYRLMVALDSATGSPVDVACEVEITECDPLPDGRFVLELESHRRCRIVKAWDQDGYR
VAEVEWVTDIPPQSDQEKADLRELTTSAASFSRAWLEKAKEAARHGDRRRLETLLIVESM
IPTPQDPERFSFWLATLTDRRPSERLELLRLQDTGERIRRGLIYLRSVERGCKMQ
Download sequence
Identical sequences M4EQG7
Bra031038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]