SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra031923 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra031923
Domain Number - Region: 448-617
Classification Level Classification E-value
Superfamily TPR-like 0.000278
Family HAT/Suf repeat 0.055
Further Details:      
 
Domain Number - Region: 250-339
Classification Level Classification E-value
Superfamily TPR-like 0.0266
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra031923
Sequence length 716
Sequence
MLARSKLALHLSRRRSHPLPPPSRYLSSSNGDDQNDASSSDSANEWENLLKPYDLSSLST
SLPKITPSQLSTLLSLPLDVPTSLALFSRTGSQPGYRHTFLSYQSLIRKLGSQSQFEAID
TLLLQMKDEGICFKESIFISIMRDYARSNLPGQTIRLLLEMRSVFSCSPTFRSYNVVLEI
LVSAGCYKVAANVFDDMLSRRIPPTLFTFGVVIKALCAINEIDSGLSLLRDMTKHGCVPN
SVIYQTLIHSLSKCSRVNEALQLLEEMLLMGCVPDAETFNDVIFGLCKFERINEAAKMVN
RMLMRGFAPDDITYGYLMNGLCKIGRVDAAKDLFSRVPKPSIVIFNTLFHGFVTQGRLDD
AKSLLSDSHGLVPDVCTFNSLIYGYLKKGLVGLALEVFRDMGVRGCKPNIFSYTIFFDGF
CKLGRIDEAFDVLRDMSADGLKLNTAGYNCLISALCKEHRVTEAIDVFKEMPSKGCKPDA
YTFNTMIAGLCEVDEIDHALWLHRDMISEGVVANTVTYNTLIKAFLRRGEIKEARKLVSE
MVFQGSPLDEITYNGLIEGLCRAGEVDKARSLFEKMLRDGVVPSNISCNILINGLCRNGK
VEEAVEFQREMVHRGTTPDIVTFNSLINGLCRAGRIGDGVAMFEKLRDEGIWPDAVTYNT
LMSWLCKGGFVEDACFLLEEGVEEGFVPNFRSWSILLRSLVPQETLDRHRFYEVVL
Download sequence
Identical sequences M4ESZ3
Bra031923 XP_009130449.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]