SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra032529 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra032529
Domain Number 1 Region: 26-160
Classification Level Classification E-value
Superfamily TPR-like 1.62e-24
Family Tetratricopeptide repeat (TPR) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra032529
Sequence length 358
Sequence
MALWMEAGSEPMTENEKADLIAITALKESAAIEFKEQGNECVKKGKKHYSEAIENYTKAI
NQGVLSDSETSILFSNRAHVNLLLGNYRRALTDAEEAIRLCSDNVKAVYRAAKASLSLDL
LSEAKSYCEKGIEKDPSNEDMKKLLKVVTLKKKEKEEHEAEVSRAVVEAKACLSAFENRG
VKIGKAMYRELTGLKKPVLDQNNILHWPVLLLYAEAMTSDFVEDFCETDIAPNMFSEDSP
PLPWDKNHEYTREAIELYYEAGSGTPLPRSRVLQYLLEGTKGSQAETTGDEDTSLPKTPY
NVKGKGSSGMVKVNERRTLHDVLKEPNLVIPEIPVFYIVSKRTRFYKDFAAGKWSPPS
Download sequence
Identical sequences M4EUP7
Bra032529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]