SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra032616 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra032616
Domain Number 1 Region: 22-199
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.09e-69
Family Inorganic pyrophosphatase 0.00000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra032616
Sequence length 203
Sequence
MSEEQQRPAPRLNERILSSLSRRSVAAHPWHDLEIAPQIFNVVVEITKGSKVKYELDKKT
GLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRARAIGLMPMI
DQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEVAVNDFLPSE
NAIEAIQYSMDLYAEYILHTLRR
Download sequence
Identical sequences M4EUY3
Bra032616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]