SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra032865 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra032865
Domain Number - Region: 50-214
Classification Level Classification E-value
Superfamily TPR-like 0.0303
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 
Domain Number - Region: 301-348
Classification Level Classification E-value
Superfamily NTF2-like 0.0993
Family Orange carotenoid protein, C-terminal domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra032865
Sequence length 574
Sequence
MQKIIPVLQQWRQQGNQIDPSHVRVIIKKLRESDQALQVSEWMLDNVVGLEEAEKCFESI
PHSARDGSFYTSLLTLYKRSDKTLCKAEATFKKMRELGLLTSPSPYNAMMSLYGALNNRD
KADELFREMQGSQEEAIKLLTLTEKLLVDPKSFKQAYELLTKLYGEAEKKEEVLRIWNLC
NENTEPYCDNNDYLTVVRSLLKLDAITEAEEIYKVWEYLPLEFDIRIPTALASGYRERGM
VDEAEKLMKSLIKNIRMKRPINPLLDQWGSRMRVSELKCLIKNLHDSNQFSKALQVSEWM
DEKRACNIYAEDYAVRLHMVDVVLGLEEAEKFFKNIPENMKDYTVYATLLSSYTKSDKHL
GKAKATFEKMRELGLLMKPSPFNSMFSFHSQRNMVEEFLREMEENNVAPDSLMVNKVLRI
YAADSNVEAMETFMKKWSGEEGIKLERETMAAVAKAYSKAGSIEQAIEMYGGLEGSKKEV
YRLWNECKKKEKEKLEDGWLSLGNECMTNEKLEDYWYKTVIASLLKLDDVEGAEKVYGEW
KPVGPNLDLRIPGLLISRFCAESNKLKVGELINL
Download sequence
Identical sequences M4EVN2
Bra032865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]