SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra033215 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra033215
Domain Number 1 Region: 249-438
Classification Level Classification E-value
Superfamily TPR-like 0.00000000407
Family Tetratricopeptide repeat (TPR) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra033215
Sequence length 512
Sequence
MLLQAVQNRNVPLASSASYSRLPRCRSPVVSVAPLKKKTAIIVCSISQVYGYGTVDYERR
PIIQWNAIYKKISLMEKPELGAASVLNQWEKGGRKLTKWELCRVVKELRKYKRPNQALEV
YDWMNKRGERFRLSASDAAIQLDLIGKVRGISDAEEFFLSLPDNFKDRRVYGSLLNAYVR
AKSREKAEALIDIMRQKGYALHPLPFNVMMTLYMNLREYDKVDAMVFEMKQKDIRLDIYS
YNIWLSSCASVEQMEQVYQQMKSDVSINPNWTTFSTMATMYIKMGEPEKAQDALRKVEAR
ITGRNRIPYHYLLSLYGSVGNKKELFRVWNVYKSVVPSIPNLGYHALVSSLVRMGDVEAA
EKVYEEWLPVKSSYDPRIPNLLMNVYVKNDQLDKAEGLFDHMIEMGGKPSPGTWEILADG
HTRKRSITEALACLKEAFSAQGSSSWRPKVLVLSGFFKLCEEESDVTSKETVLELLSQSG
HLQDKSYQALIDADENDAHDTDVLVTQLQDDL
Download sequence
Identical sequences M4EWN1
XP_009119759.1.100322 Bra033215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]