SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra033224 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra033224
Domain Number - Region: 95-354
Classification Level Classification E-value
Superfamily TPR-like 0.0379
Family BTAD-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra033224
Sequence length 403
Sequence
MMGVYSCNAVLNSVFPFVGGGGSHHKLYFSPKTPFSVEESRHRFSCKCRMAMEVVDKEEK
GPPRRFNWVDVNSHHITEEQEEAITRIPVKMSKRCQALMKQIICFEKGSSFSDMLGAWVR
RMKPIRADWLSLLKELNNLHSPFYIKVAEFALLEDSFEANPRDYTKIIHYYGKLNQIQEA
EKTLVSMKSRGFLIDQVTLTAMVQSYSKAGFHRLAEETFNDIKLLGEPLDYRSYGSMIMA
YIRAGTPEKGEALLREMDSHDICAGREVYKALLRSYSMSGDPQGSKRVFDALQIAGITPD
AKLCGLLINAYSVSGQSQNARLAFENMRKAGIKATDKCVALVLSAYEMEEKLNEALGFLV
ELEKDSIMVGEEASAVLARWFKKLGVVEEVELLLREFSSHKTL
Download sequence
Identical sequences M4EWP0
Bra033224 XP_009119748.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]