SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra033225 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra033225
Domain Number 1 Region: 422-615,643-673
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.44e-29
Family Phospholipase D 0.079
Further Details:      
 
Domain Number 2 Region: 716-863,912-1001
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.52e-28
Family Nuclease 0.052
Further Details:      
 
Domain Number 3 Region: 257-396
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.59e-24
Family PLC-like (P variant) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra033225
Sequence length 1070
Sequence
MENYGSRYPYPYPQYPYQPSYQYPPAPYRPPGPGSEQYQPPPPPYYPYPLPPPYATPPPY
ASPPPLHQHASGSHSGPLDYPPQPSSSPEYHRHSFDYRPSPYPPHPQGTYAPPPPHYPYQ
EPAAQYAPPETKPQDPTPPPPSKSQAFPEYRRQDCLTSVPNDNVSNSASSYPPVDELLGG
LRISDKPQLSSYPSNSWHPRPADLYGYPNSSFPSNSHLPILDRVDSSTSGYASSESPHGV
DMRMTLFGKGSLKVLLLHGNFDIWIYHAKNLPNMDMFHKTLGDVFGGQLNRKITSDPYVS
VSVAGAVIGRTYVMSNSENPVWMQHFYVPVAHHAAEVHFVVKDSDVVGSQLIGLVTIPVE
QIYSGAKIEGTFPILSSNGKPCKPGANLSLSIQYTPMEKLSVYHHGVGAGPDYQGVPGTY
FPLRKGGTVTLYQDAHVPEGMLPGIRLDNGMSYQHGKCWHDMFDAIRQARRLIYITGWSV
WHKVRLVRDKVGPASACTLGELLRSKSQEGVRVLLLVWDDPTSRSILGYKTDGVMATHDE
ETRRFFKHSSVQVLLCPRNAGKRHSWVKQREVGTIYTHHQKNVIVDADAGANRRKIVAFV
GGLDLCDGRYDTPQHPLFRTLQTIHKDDFHNPTFTGNLSGCPREPWHDLHSKIDGPAAYD
VLTNFEERWLKAAKPSGIKKFKTSGIKKFKTSYDDALLRIDRIPDIVGVSDTPTISENDP
EAWHVQIFRSIDSNSVKGFPKDPKDATCKNLVCGKNVLIDMSIHTAYVKAIRAAQHFIYI
ENQYFIGSSYNWNAHKDIGANNLIPMEIALKIAEKIRANERFAAYIVIPMWPEGVPTGAA
TQRILYWQHKTMQMMYETIYKALVETGLEGAFSPQDYLNFFCLGNREMVDGIDNSGTGSP
SNANTPQALSRKSRRFMIYVHSKGMVVDDEYVVIGSANINQRSMEGTRDTEIAMGAYQPQ
HTWARKHSGPRGQIYGYRMSLWAEHMATLDDCFTQPESIECVRKVRTMGERNWEQFAAEE
VSDMRGHLLKYPVEVDRKGKVRPLPGSEAFPDVGGNIVGSFIAIQENLTI
Download sequence
Identical sequences M4EWP1
Bra033225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]