SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra033292 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra033292
Domain Number 1 Region: 28-208
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 9.81e-71
Family Inorganic pyrophosphatase 0.0000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra033292
Sequence length 212
Sequence
MSEETKENQKLQRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSK
VKYELDKKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRA
RAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEV
AVNDFLPSEKAVDAIQYSMDLYAEYILHTLRR
Download sequence
Identical sequences M4EWV7
XP_009119663.1.100322 Bra033292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]