SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra034040 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra034040
Domain Number 1 Region: 37-134
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 8.37e-17
Family Glycerophosphoryl diester phosphodiesterase 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra034040
Sequence length 136
Sequence
MRASTVLLNSIVLIQLFAAQIDAKGSKSPWQTFSGDAPLVIARGGFSGLFPDSSIDAYNF
AMQTSVAGAVLCCDVQLTKDGHGVSFPDLKLNNASNIGDIYPNRQKSYPVNGVTTHGWFT
IDFSLRDINNVSCKYL
Download sequence
Identical sequences M4EYZ7
Bra034040 XP_009127509.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]