SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra034352 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra034352
Domain Number 1 Region: 5-317
Classification Level Classification E-value
Superfamily L domain-like 5.21e-42
Family Internalin LRR domain 0.027
Further Details:      
 
Domain Number 2 Region: 473-649
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-36
Family BCR-homology GTPase activation domain (BH-domain) 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra034352
Sequence length 718
Sequence
MNGCSSLMHFPEFSWNARRLYLSSTKIEELPSSMISRLSCLVELDMSDCQSIRTLPSSVK
HLVSLKSLSLNGCKHLENLPDSLQNLTSLENLEVSGCLNINEFPRLAKNIEVLRISETSI
NEVPARICDLSQLRSLDISGNEKLKSLPVSISELRSLEKLKLSGCCVLESLPPEICQTMS
CLRWLDLERTSIKELPENIGNLIALEVLQAGRTAIRRAPLSIARLERLQVLAIGNSFYTS
QGLHSLCPHLSIFNDLRALCLSNMNMIEIPNSIGNLWSLSELDLSGNNFEHIPASIRRLT
RLSRLDVNNCQRLQALPDDLPRRLLYIYAHGCTSLVSISGCFKPCCLRKLVASNCYKLDQ
EAQILIHRNMKLDAAKPEHSYFPGRDVPSCFNHQAMGSSLRIRQPSSDILGFSACIMIGV
DGELIGINILIREEGGKELSWQVRRELRSLSDTWKSSEERGMSINRFVEWHATVFGVSTE
SMQLSYDSRGNCVPIILSLLQRRLYDQGGLKVEGIFRITGDNSEEEFVREELNKGVVPEG
IDVHCLSGLIKAWFRELPRGILDSLPSEQVMQCESEEDFVKVVRLLPQAEASLLNWAVNL
MADIVEHEDVNKMTTRNLALVFAPNMSKMADPLTALMYAVQVMHLLKNLTEKTLRERKVA
SSQIVPCDDSEADVEECNQEEEEKGVDDVNKEEEIIKVEDEVKPSNGLDFDKEKREKT
Download sequence
Identical sequences M4EZV9
Bra034352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]