SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra034722 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra034722
Domain Number 1 Region: 31-180
Classification Level Classification E-value
Superfamily Plant invertase/pectin methylesterase inhibitor 4.32e-22
Family Plant invertase/pectin methylesterase inhibitor 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra034722
Sequence length 181
Sequence
MKLKMEFSSIIAKLLLLTTLVTTLVISRANEELMMQLCHNSDNPTLCLRCLSSDPTAPKA
DHVELARIILRCVNSHLITLTNNTSTLAPKHRRDPKAAAALKQCGLGYATAKRGVGKVDA
HLIAGDYDKAAYDVSMTVEAPPVSCRASLVTLNFNLPSSFRYHTEVYLALTQALLRIIDR
F
Download sequence
Identical sequences A0A078F4P6 M4F0X7
XP_009146576.1.100322 XP_013640076.1.73403 XP_013640077.1.73403 XP_013749902.1.73403 Bra034722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]