SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra034837 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra034837
Domain Number 1 Region: 2-46
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000706
Family BCR-homology GTPase activation domain (BH-domain) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra034837
Sequence length 118
Sequence
MLPSTEASLLDWSINLMADVVEMEHVKKMNARNIAMVFAPNMTQDRKESRDRLIPGSNPS
PRDENGDQTSRQLVHLMEANMEVALDDTFEVEMKDKEDSAEEEEYAEPREILGVKSEG
Download sequence
Identical sequences A0A078F576 M4F191
Bra034837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]