SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra034939 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra034939
Domain Number 1 Region: 531-631,675-764
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.55e-29
Family Polyphosphate kinase C-terminal domain 0.093
Further Details:      
 
Domain Number 2 Region: 180-382,408-443
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1e-28
Family Phospholipase D 0.061
Further Details:      
 
Domain Number 3 Region: 12-165
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.32e-25
Family PLC-like (P variant) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra034939
Sequence length 833
Sequence
MANVKQSGLVYLHGDLELQIIEARYLPNMDLHFERIRRVFNTLNLFDKHSSSPKGSHRRT
RNNIITSDPYVTVCLAGATVARTRVISNSQNPVWSEHFKIPLAHPVSQIEFYVKDNDVFG
ADLIGIATVSTAKIKLGETINGWFPIIGSPKPDSAVRLEMRFVPYEKNPLYNHGITSTGV
ANCYFPVRTGGHVTLYQDAHVHDNMPEIELEDGVLYQHERCWEDICHSILEAHHMVYVIG
WSIFHKVKLVRDQSRKLPNGGDLSLGDLLKYKSQEGVRVLLLVWDDRTSHSKFFINTTGV
MQTHDEETRKFFRRSSVTCVLSPRYASSKLSIFKQQVVGTVFSHHQKCVIVDTQASGNNR
KIAAFIGGLDLCDGRYDTPEHRLFKGLDTVFQGDYHNPTFSGGTKAPRQPWHDLHCKIEG
PAAYDILINFEQRWKKATKWSEIGQKFKRVTRWHDDSLIKLERISWILSPSTAVPTNDTL
WVSKDDDKQNWHVQVFRSIDSGSLKGFPKDVHKAHAQNLVCAKNLVIEKSIQTAYIQAIR
SAQHFIYIENQYFIGSSFVWPNYKEAGADNLVPIELALKIATKIRARERFAVYIVIPMWP
EGDPSSAPVQEILYWQGQTMQMMYEIIAREIKHMDLENVNPQDYLNFYCLGNREELPSDQ
NCVSSSGEMVPASQKWGRFMIYVHAKGMVVDDEYVLLGSANINQRSMAGSRDTEIAMGAY
QNHQTWGHRNKHPRGQVYGYRMSLWAEHMGKIDDIFKEPETLECVKRVNMISEDNWKKYT
DDSFVPLQGHLLKYPLSVDHTGKVIPLSGFNSFPDVGGKILGTRTNLPDVLTT
Download sequence
Identical sequences M4F1J3
Bra034939 XP_009107633.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]