SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra035290 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra035290
Domain Number 1 Region: 258-370,405-506,716-780
Classification Level Classification E-value
Superfamily TPR-like 0.0000106
Family Tetratricopeptide repeat (TPR) 0.069
Further Details:      
 
Domain Number 2 Region: 120-218,291-396
Classification Level Classification E-value
Superfamily HCP-like 0.0000837
Family HCP-like 0.03
Further Details:      
 
Weak hits

Sequence:  Bra035290
Domain Number - Region: 581-709
Classification Level Classification E-value
Superfamily HAD-like 0.0783
Family NagD-like 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra035290
Sequence length 800
Sequence
MADKLALPLLLPSTPSPKPLFHDHHQLSRTPFLTSQTPPPSPVEPLLHDVFLHQNPNSRR
PITPQPPKTHSPFLNRTHFRFRPIRHGQQILRSLIEPTFDSGQLGPLLSQLSESSSSELL
ALLKGLGFHKRFDLALSVFDWFMKQKDYQLDNSVVAVVISMLGKEGRVSSAANLFNGLIE
NGFSLDVYSYTSLISAFANSGRYRDAVMVFKKMEEEGCKPTLITYNVVLNVFGKMGTPWS
KITSLVEKMKSDGIAPDAYTYNTLITCCKRGSLHEEAARVFQEMKMAGFSHDKVTYNALL
DVYGKSHRPKEAMKVLNEMELSGFTPSIVTYNSLISAYARDGMLDEAMELKNQMVGKGMK
PDVFTYTTLLSGFERAGKVESAMSVFEEMRNAGCKPNICTFNAFIKMYGNRGKFAEMMKI
FDEINVCGLSPDIVTWNTLLAVFGQNGMDSEVSGVFKEMKRAGFVPERETFNTLISAYSR
CGSFEQAMTVYRRMLEAGVTPDLSTYNTVLAALARGGMWEQSEKVLAEMEDGRCKPNELT
YCSLLHAYANGKEIGRMHFLAEEVYSGVIEPRAVLLKTLVLVCSKCDLLPEAERAFSELK
ERGFSPDITTLNSMVSIYGRRQMVAKANEVLDYMKEMGFTPSMATYNSLMYMHSRSADFG
KSEEILREIQAKGIKPDIISYNTVIYAYCRNTRMRDASRIFAEMRDSGIVPDVITYNTFI
GSYAADSMFEEAIGVVRYMIKNGCRPNQNTYNSIVDGYCKLNRKDEAKLFAEDLKNLDPH
APKDEEQRLLERIVKKWPIR
Download sequence
Identical sequences M4F2J1
Bra035290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]