SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra035829 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra035829
Domain Number - Region: 307-371
Classification Level Classification E-value
Superfamily TPR-like 0.00645
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra035829
Sequence length 421
Sequence
MSSSLSSPVLKLARPFLRGELEKINPKLPSLIAVLKSVGAGECWHKHGNFLDHLVDVYKI
LKLWKAPEPVCLCGLFHSAYSNSYVNLAIFDPSTGRDVVRGHVGEAAESLVHLFCVIPRQ
TLIHDDVLFKYSDLELVEHLELSEVSLRNAKEKGVFDGEEVWRKKLNGLVPENGVVVKHI
KTGEEILVSRRVVGVFLLITMADFSDQFFGFQDELFCNNDGRLEFRGNNVTALWPGNGKP
GLWMNSSSRTGAIYSLIVREEEILMEQRKRGYGSEFVARKERDEDIELVVPPVFSFCTKV
LDAKEQIEARDMYWEAVSSDASKEGYLERAEKMLLGCIEKNPFVGEPHVLLSQVYLGKKR
FVEAEREAERGLVLLLQWGSPWDKRMSWEGWIAWVRVLLMKSSDQSWPDVSWGILNLGLV
R
Download sequence
Identical sequences M4F429
Bra035829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]