SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra035925 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra035925
Domain Number 1 Region: 133-292,340-368
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.00031
Further Details:      
 
Weak hits

Sequence:  Bra035925
Domain Number - Region: 7-118
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0824
Family Apolipoprotein A-I 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra035925
Sequence length 377
Sequence
MSSLISQQWQERTSGFFSSSGTKLREARQSAGSFVGEVAKDAKVNVADVAERVGSLFKSR
WAILQQPATRHAVQEHLITAAATTGTLVRKGITETKEKVSVGKIKVEEAAKKTAQKSKTL
LTDIERWQKGVASSDVFGVAIEVTVQRQESSRPIPFILMKCADYLILTGLNTPNLFKTEG
DKKLIQQLVSAYNQDPSASIPEGVNPVDVAALIKYYLASLPTPLTTFELYNEIKDARSSV
TRMRKSLQKLSSVNYNTLEFITALLLRVSQKAQLNKMDSHSLAMEMAPVIMWREEKRPES
YREYWRRPSRSPKKSIDFETASPWDLLSDEGEGVVDASSSISLDDIVQVDFGAVDVVQCL
IEHHNAIFTDAGETVWR
Download sequence
Identical sequences M4F4C5
Bra035925 XP_009111993.1.100322 XP_013661096.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]