SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra036822 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra036822
Domain Number 1 Region: 116-173,230-290
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000109
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra036822
Sequence length 364
Sequence
MKRPARGTTCKGLCISAGWAWAELLETASHAGLTRRNPQERKPEAVRVRTGTGRNNPFDN
ISSGRLIKPQHLSPFTTPLRFICRLHSLQRCIQTNQIRSVLSRKATRHLPHTLVEKDPER
AIPLFWSAINAGDRVDSALKDIAIVMKQQDRTKEAIEAIKSFRVRCSDQAHESLDNILLD
LYKRCGRLDDHIALLKHKLFLIQKGLAFNCKRTKTARSQGKKFQVSVEQEATRLLGNLGW
ALMQRDNFVEAEDAYRRALSIAPDNNKMCNLGICLMKQGRIDEAKETLRRPQPCREQQNV
KPKAKPGGYGDENVKTNVNVVVNNPLRVDAKPFFSLKLVRNNEKLKRTRSSSQTMGMLSC
CGEE
Download sequence
Identical sequences M4F6W2
Bra036822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]