SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra037229 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra037229
Domain Number 1 Region: 32-214
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.31e-67
Family Inorganic pyrophosphatase 0.00000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra037229
Sequence length 219
Sequence
MADIKDEGTPKSSASSPLRNPNVTLNERNFAAFTHRSAAAHPWHDLEIGPEAPAVFNCVV
EISKGGKVKYELDKNSGLIKVDRVLYSSIVYPHNYGFIPRTICEDSDPIDVLVLMQEPVL
TGSFLRARAIGLMPMIDQGEKDDKIIAVCADDPEFRHYRDIKELPPHRLAEIRRFFEDYK
KNENKKVDVEGFLPAQAAIDAIKDSMDLYAAYIKAGLQR
Download sequence
Identical sequences A0A078GXT9 M4F818
XP_013652973.1.73403 XP_013652974.1.73403 Bra037229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]