SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra037416 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra037416
Domain Number 1 Region: 29-210
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.35e-70
Family Inorganic pyrophosphatase 0.00000416
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra037416
Sequence length 214
Sequence
MSEEVKENQSDKLQRTAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPSIFNVVIEISKG
SKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVIMQEPVLPGCFL
RARAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENK
EVAVNDFLPNGPAVEAIQYSMDLYAEYILHTLRR
Download sequence
Identical sequences A0A0D3DZU7 M4F8K4
XP_009111378.1.100322 XP_013608807.1.26608 Bra037416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]