SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra037452 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra037452
Domain Number - Region: 319-483
Classification Level Classification E-value
Superfamily TPR-like 0.0012
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra037452
Sequence length 672
Sequence
MNPTQTLYPSGGNSPSPHSTHPSSLFPQINRCRTMRDLSQIHATFVKSGQMRDTLAAAEL
LRFCAPPSDLLHRDLDYAHKIFTQMPHRNTFSWNTIIRGFSESEEQNAIIAIALFHEMMK
DSVQPNRFTFPSLLKACAKTGRIEEGKQIHALALKLGLSGDEFVMSNLVSVYVVCGLMRD
ACVLFYKNIIGRDMAVNMMVDGGRKRDGEVVIWNVMIDGYMRLGDCKGDCKAARTLFDQM
RVRSVVSWNTMISGYCKNGCFKEAVEIFCEMRRVDLRLSYVTLVSVLPAVSRIGSLELGE
WLHSYAESNRVEVDDVLGSALIDMYSKCGVVERAVEVFERLPRKNVITWSAMINGFAIHG
LAGDAIDCFCRMREAGVKPSDVAYINLLTACSHAGLVEEGRKYFSQMVNVDGLDPRIEHY
GCMVDLLGRSGLLEEAEQFIHNMPVKPDDVIWKALLGACRMHGNVEMGKRVANILMDMVP
QDSGAYVALSNMYASQGNWSEVSEMRLRMKEMDIRKDPGCSWIDVDGVLHEFLVEDDSHP
RAKDINSKLAEISEKLRLAGYRPITTQVLLNLEEEDKENALHYHSEKIAVAFGLISTTPG
KPIRIVKNLRISKSEYTNQQSTHKGNIEENMVTHTKSISNLALQRVSNRSQQQQKQRLHT
IKSGYLILSKFT
Download sequence
Identical sequences M4F8P0
XP_009151731.1.100322 Bra037452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]