SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra037820 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra037820
Domain Number 1 Region: 71-196
Classification Level Classification E-value
Superfamily TPR-like 0.000000000211
Family Tetratricopeptide repeat (TPR) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bra037820
Sequence length 197
Sequence
MATEPLIQGAIMLLAFVMFWALKYLSQQGLTKFRSKHRATLQTQRQLIQASRLLARARAT
TKKSQSQSLAKTALTEADDVIALSPDDAAGHIVRALSLDLLGHHTAALKSFDTALTYPRL
KSLSAGERADALVKRAEMKVAVNRRRRNDSAIEDLEEAVRLAAGTDTARIFRLLGECYEY
KGLGEKAQWAFSEALKA
Download sequence
Identical sequences M4F9Q7
XP_009112189.1.100322 Bra037820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]