SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra038248 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bra038248
Domain Number - Region: 310-373
Classification Level Classification E-value
Superfamily TPR-like 0.00675
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra038248
Sequence length 423
Sequence
MGSSPNLSTVLDLARPFLRGELENIDPNLPSLIAVLKSVGAGECWHKHGSFLDHLIDIYK
MLKLWKAPDPVCLCGLFHSAYSNSYVNLAIFHPSTGRHVVRGHVGQPAEALIHLFCVVPR
QTLIHDDLLFKYSDQELVEHLDRSEVSLRKAKEEGGFDREEEWRRKVNELVPEDGVVVKH
IKTGDEIVVSRRVVGVFLLMTMADFSDQLFGFQDELFCNDDGRLEFRGNNVWALWPGSGK
PGLWMNSNSRMGAVYSLIVREEEILMEQRKRDCGGSGFVVRKERDEDIELVVPPVFSFCT
KVLDAKEQIEARDMYWEAVTSDASKDGYLERAEERLLGCIEKNPFVGEPHVLLSQVYLGK
KRFAEAEREAERGLLLLLQWGSPWDKRMSWEGWIAWVRVLLMKSQDQSWPDASWGILNLG
LVR
Download sequence
Identical sequences M4FAY2
Bra038248 XP_009111322.1.100322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]