SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra038762 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra038762
Domain Number 1 Region: 113-196,262-298,350-397
Classification Level Classification E-value
Superfamily TPR-like 0.0000152
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bra038762
Sequence length 488
Sequence
MNILRRIPANLFTSRYYYTNRVKKTTLYSKISPLGNPKSSVYPELQNWVHSGNKVSVAEL
IRIVHDLRRRKRFLHALEVSKWMNETGVCIFSPTEHAVHLDLVGRVHGFVSAEAYFESLK
EHHKNDKTHGALLNCYVRQQDVEKSLLHFEKMKELGYASSSLTYNNIMCLYTNLGQHEKV
PRVLDEMKEENVAPDNYSYRLCINAFGVMNDLEGIGEILRDMETVDWNTYAVAAKFYIDG
GDRGKAVELLRMSEDRLESKDGEGYNHLITLYSKLGDKGEVLRLWELEKDACKRRINQDY
LTVLQSLVKIDALKEAEEVVKEWEASSGNCYDFRVPSVVIRGYVGRGMEERAEAMLEDLG
RRGKGTTPDSWGLVAAAYVEKGVLDNAYKCLKTALDVEVGKRKWRPGVKVVTSVLSWVGD
EGSLREVESFVASLRNCMGVNREMYHALVKADIREGGSSVDTLLQRMKEDKIETNEETMA
ILSTRSHC
Download sequence
Identical sequences M4FCE3
XP_009137206.1.100322 Bra038762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]