SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bra038794 from Brassica rapa Chiifu-401 1.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bra038794
Domain Number 1 Region: 71-127,190-282
Classification Level Classification E-value
Superfamily TPR-like 0.000000000201
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bra038794
Sequence length 432
Sequence
MCPFEDRRAPPGVYWTPPPARRTENAAAMPMPLSERRRPPSSEKRDPFHIVHKVPSGDSP
YVRAKHAQLVYKDPNRAISLFWAAINAGDRVDSALKDMAVVFKKLDRSDEGIEAIKSFRY
LCPFEAQDSIDNLLLELYKKSGRIQEEAELLEHKLKVIEQGMGFGGRIVRAKRVQGKHVT
MTVEQEKARVLGNLGWVHLQLHNYGIAEQHYRRALCLEPDKNKQCNLAICLMRMGRIPEA
KSMIDAVRDSSAETESGDEPFTKSYNRAVEMLAEVESKDPEDGLSDKFYAGCSFANGTMK
ENKAPRNANRNHSHVPPSPASVRQNSAGLFTQPRGCKGDPKNGVSEEETGGAARKLLFDK
PIGSQRVKLLKSGEGEQHVKGKKLDQNMIQDLHEYIKDTADCLKSGSKKSWADMAEEEDE
ESVQSQLKTAKI
Download sequence
Identical sequences M4FCH5
XP_018512518.1.100322 Bra038794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]